- TRIM3/BERP Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-48897
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- TRIM3/BERP
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: QHKAALQRQL EAVRGRLPQL SAAIALVGGI SQQLQERKAE ALAQISAAFE DLEQALQQRK QALVSDLETI CGAKQKVLQ
- tripartite motif containing 3
- BERP, HAC1, RNF22, RNF97
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
QHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQ
Specifications/Features
Available conjugates: Unconjugated